Bacterial PRGJ protein
This Bacterial PRGJ protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
PrgJ, STM2872Protein PrgJ
UniProt
P41785
Expression Region
1-101aa
Tag
N-terminal 6xHis-sumostar-tagged
Source
Yeast
Origin
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
26.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 1-101aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
125812-Biotin 100 µL
DHDH (2DD, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, D-xylose 1-dehydrogenase, D-xylose-NADP Dehydrogenase, Dimeric Dihydrodiol Dehydrogenase, Hum2DD) (Biotin)
Sign In for Pricing
View Details MBS7015838-01 0.02 mg
Recombinant Escherichia coli Rhomboid protease glpG (glpG)
Sign In for Pricing
View Details MBS7015838-02 0.1 mg
Recombinant Escherichia coli Rhomboid protease glpG (glpG)
Sign In for Pricing
View Details MBS7015838-03 5x 0.1 mg
Recombinant Escherichia coli Rhomboid protease glpG (glpG)
Sign In for Pricing
View Details 