Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial PRGJ protein

This Bacterial PRGJ protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PrgJ, STM2872Protein PrgJ

UniProt

P41785

Expression Region

1-101aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 1-101aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mannose Associated Serine Protease 1 (MASP1) ELISA Kit
orb2667835-01 48 Tests

Mouse Mannose Associated Serine Protease 1 (MASP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Mannose Associated Serine Protease 1 (MASP1) ELISA Kit
orb2667835-02 96 Tests

Mouse Mannose Associated Serine Protease 1 (MASP1) ELISA Kit

Sign In for Pricing
View Details
NCI-H661 Cell Lines Complete Growth Medium 500ML
INCIH661CLCGM500ML 500 mL

NCI-H661 Cell Lines Complete Growth Medium 500ML

Sign In for Pricing
View Details
MV DNA Purification Kit
DC3715-02 250 / Box

MV DNA Purification Kit

Sign In for Pricing
View Details
Hsa-miR-1226-5p miRNA Agomir
orb1920848-01 5 nmol

Hsa-miR-1226-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-1226-5p miRNA Agomir
orb1920848-02 10 nmol

Hsa-miR-1226-5p miRNA Agomir

Sign In for Pricing
View Details