Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli PPIA protein

This E. coli PPIA protein spans the amino acid sequence from region 25-190aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclophilin A Rotamase A

UniProt

P0AFL4

Expression Region

25-190aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 25-190aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP2K3 Protein (N-His, Human)
P526578 100 µg

MAP2K3 Protein (N-His, Human)

Sign In for Pricing
View Details
HDAC1, NT (HDAC1, RPD3L1, Histone deacetylase 1) (APC)
MBS6305868-01 0.2 mL

HDAC1, NT (HDAC1, RPD3L1, Histone deacetylase 1) (APC)

Sign In for Pricing
View Details
HDAC1, NT (HDAC1, RPD3L1, Histone deacetylase 1) (APC)
MBS6305868-02 5x 0.2 mL

HDAC1, NT (HDAC1, RPD3L1, Histone deacetylase 1) (APC)

Sign In for Pricing
View Details
COL9A2 Antibody (Biotin)
orb686231-01 50 μL

COL9A2 Antibody (Biotin)

Sign In for Pricing
View Details
COL9A2 Antibody (Biotin)
orb686231-02 100 µL

COL9A2 Antibody (Biotin)

Sign In for Pricing
View Details
Sialyl-Lewis a-hexa-APD-HSA conjugate
60/69-0005 0.5 mg

Sialyl-Lewis a-hexa-APD-HSA conjugate

Sign In for Pricing
View Details