What is the catalog number for Animal Limulus clotting factor C protein?

The catalog number for Animal Limulus clotting factor C protein is orb418994.

What sizes are available for Animal Limulus clotting factor C protein?

Animal Limulus clotting factor C protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Animal Limulus clotting factor C protein come in?

Animal Limulus clotting factor C protein is available in 3 different pack sizes.

Is Animal Limulus clotting factor C protein in stock?

Animal Limulus clotting factor C protein is currently made to order / not held in immediate stock. Contact us for lead time.

Animal Limulus clotting factor C protein

This Animal Limulus clotting factor C protein spans the amino acid sequence from region 763-1019aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Limulus clotting factor C, FC, EC 3.4.21.84) [Cleaved into, Limulus clotting factor C heavy chain, Limulus clotting factor C light chain, Limulus clotting factor C chain A, Limulus clotting factor C chain B]

UniProt

P28175

Expression Region

763-1019aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Tachypleus tridentatus (Japanese horseshoe crab)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 763-1019aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPSQFKIYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSEMIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI