Animal Limulus clotting factor C protein
This Animal Limulus clotting factor C protein spans the amino acid sequence from region 763-1019aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Limulus clotting factor C, FC, EC 3.4.21.84) [Cleaved into, Limulus clotting factor C heavy chain, Limulus clotting factor C light chain, Limulus clotting factor C chain A, Limulus clotting factor C chain B]
UniProt
P28175
Expression Region
763-1019aa
Tag
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Source
Yeast
Origin
Tachypleus tridentatus (Japanese horseshoe crab)
Field of Research
Epigenetics
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
32.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-taggedExpression Region: 763-1019aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
IWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPSQFKIYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSEMIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
T0854 1x106 cells / 1.0 mL
Immortalized Human Prostate Epithelial Cells (P69SV40T)
Sign In for Pricing
View Details OR1050715-01 100 mg
1- (2-Ethylphenyl) -5-oxopyrrolidine-3-carboxylic acid
Sign In for Pricing
View Details OR1050715-02 250 mg
1- (2-Ethylphenyl) -5-oxopyrrolidine-3-carboxylic acid
Sign In for Pricing
View Details 
MBS6390087-01 0.1 mL
POLE (DNA Polymerase epsilon Catalytic Subunit A, DNA Polymerase II Subunit A, POLE1, DKFZp434F222, FLJ21434) (AP)
Sign In for Pricing
View Details MBS6390087-02 5x 0.1 mL
POLE (DNA Polymerase epsilon Catalytic Subunit A, DNA Polymerase II Subunit A, POLE1, DKFZp434F222, FLJ21434) (AP)
Sign In for Pricing
View Details