Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse VRK1 protein

This Mouse VRK1 protein spans the amino acid sequence from region 1-440aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serine/threonine-protein kinase 51PK Vaccinia-related kinase 1

UniProt

Q80X41

Expression Region

1-440aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-140aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPRVKAAQAGRPGPAKRRLAEQFAAGEVLTDMSRKEWKLGLPIGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTHKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLSHKNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHDGTLEFTSIDAHKGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRDSKIRYRDNVAALMEKCFPEKNKPGEIAKYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVKTRPASKKRKKEAEESAVCAVEDMECSDTQVQEAAQTRSVESQGAIHGSMSQPAAGCSSSDSSRRQQHLGLEQDMLRLDRRGSRTRKKAQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beclin Antibody
orb76564-01 50 μL

Beclin Antibody

Sign In for Pricing
View Details
Beclin Antibody
orb76564-02 100 µL

Beclin Antibody

Sign In for Pricing
View Details
CDC42EP2 siRNA (Mouse)
CRN0656-01 15 nmol

CDC42EP2 siRNA (Mouse)

Sign In for Pricing
View Details
CDC42EP2 siRNA (Mouse)
CRN0656-02 30 nmol

CDC42EP2 siRNA (Mouse)

Sign In for Pricing
View Details
Nipah virus/NiV Glycoprotein G Antibody
orb3155541-01 50 µg

Nipah virus/NiV Glycoprotein G Antibody

Sign In for Pricing
View Details
Nipah virus/NiV Glycoprotein G Antibody
orb3155541-02 100 µg

Nipah virus/NiV Glycoprotein G Antibody

Sign In for Pricing
View Details