Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CRYGB protein

This Rat CRYGB protein spans the amino acid sequence from region 2-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gamma-B-crystallin Gamma-crystallin 1-2

UniProt

P10066

Expression Region

2-175aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 2-175aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Barbiturates (PE) discontinued
214532-PE 100 µL

Barbiturates (PE) discontinued

Sign In for Pricing
View Details
VWA2 siRNA (Human)
MBS8227764-01 15 nmol

VWA2 siRNA (Human)

Sign In for Pricing
View Details
VWA2 siRNA (Human)
MBS8227764-02 30 nmol

VWA2 siRNA (Human)

Sign In for Pricing
View Details
VWA2 siRNA (Human)
MBS8227764-03 5x 30 nmol

VWA2 siRNA (Human)

Sign In for Pricing
View Details
PID1 Rabbit Polyclonal Antibody (BF555)
orb2387361 100 µL

PID1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
PE Anti-Human CD49d (Integrin alpha 4) (9F10)
orb1215288-01 25 Tests

PE Anti-Human CD49d (Integrin alpha 4) (9F10)

Sign In for Pricing
View Details