Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Aquaporin 4 protein

This Mouse Aquaporin 4 protein spans the amino acid sequence from region 253-323aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mercurial-insensitive water channel

UniProt

P55088

Expression Region

253-323aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Kidney & Urological Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 253-323aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (DE-K18), CF568 conjugate, 0.1mg/mL
BNC680563-100 1x 100 µL

Cytokeratin 18 (DE-K18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Cystatin 7/CST7 Protein (His Tag)
PKSH032325-01 10 µg

Recombinant Human Cystatin 7/CST7 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Cystatin 7/CST7 Protein (His Tag)
PKSH032325-02 50 µg

Recombinant Human Cystatin 7/CST7 Protein (His Tag)

Sign In for Pricing
View Details
Human CCDC13 activation kit by CRISPRa
GA115828 1 Kit

Human CCDC13 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD22 Antibody[Cy34.1]
E-AB-F1021M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD22 Antibody[Cy34.1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD22 Antibody[Cy34.1]
E-AB-F1021M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD22 Antibody[Cy34.1]

Sign In for Pricing
View Details