Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Transthyretin protein

This Mouse Transthyretin protein spans the amino acid sequence from region 23-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Prealbumin

UniProt

P07309

Expression Region

23-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 23-147aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRAP CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
30384154 3x 1.0 µg DNA

MRAP CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Rat Dgkd Pre-designed siRNA Set A
SI203745A 1 Each

Rat Dgkd Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human YWHAH Protein, N-His
HC326012-01 50 µg

Recombinant Human YWHAH Protein, N-His

Sign In for Pricing
View Details
Recombinant Human YWHAH Protein, N-His
HC326012-02 100 µg

Recombinant Human YWHAH Protein, N-His

Sign In for Pricing
View Details
Recombinant Human YWHAH Protein, N-His
HC326012-03 1 mg

Recombinant Human YWHAH Protein, N-His

Sign In for Pricing
View Details
1.0 M HEPES pH 7.2
OORA00243-500ML 500 mL

1.0 M HEPES pH 7.2

Sign In for Pricing
View Details