Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Transthyretin protein

This Mouse Transthyretin protein spans the amino acid sequence from region 23-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Prealbumin

UniProt

P07309

Expression Region

23-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 23-147aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVRL1 Antibody - N-terminal region : Biotin (ARP44199_P050-Biotin)
ARP44199_P050-Biotin 100 µL

ACVRL1 Antibody - N-terminal region : Biotin (ARP44199_P050-Biotin)

Sign In for Pricing
View Details
Doxacurium Chloride (Mixture of Diastereomers)
TRC-D537470-100MG 100 mg

Doxacurium Chloride (Mixture of Diastereomers)

Sign In for Pricing
View Details
ARD1A (NAA10) (NM_003491) Human Tagged ORF Clone
RG201354 10 µg

ARD1A (NAA10) (NM_003491) Human Tagged ORF Clone

Sign In for Pricing
View Details
CNGA4 Protein Vector (Mouse) (pPB-N-His)
PV166627 500 ng

CNGA4 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Anti-human TAFI Antibody
B2014464 0.5 mg

Anti-human TAFI Antibody

Sign In for Pricing
View Details
CF®568 Goat Anti-Mouse IgG1 (γ1), 2mg/mL
#20248-1 1x 50 µL

CF®568 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

Sign In for Pricing
View Details