Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Transthyretin protein

This Mouse Transthyretin protein spans the amino acid sequence from region 23-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Prealbumin

UniProt

P07309

Expression Region

23-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 23-147aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf78 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-15342R-BF750 100 µL

C9orf78 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Magic™ Membrane Protein Human NCR1 (Natural cytotoxicity triggering receptor 1) for Antibody Discovery
MP0775J Each

Magic™ Membrane Protein Human NCR1 (Natural cytotoxicity triggering receptor 1) for Antibody Discovery

Sign In for Pricing
View Details
Human Malectin (MLEC) ELISA Kit
AE33403HU-01 48 Tests

Human Malectin (MLEC) ELISA Kit

Sign In for Pricing
View Details
Human Malectin (MLEC) ELISA Kit
AE33403HU-02 96 Tests

Human Malectin (MLEC) ELISA Kit

Sign In for Pricing
View Details
PSMA1 Conjugated Antibody
MBS9443789-01 0.1 mL (Biotin)

PSMA1 Conjugated Antibody

Sign In for Pricing
View Details
PSMA1 Conjugated Antibody
MBS9443789-02 0.1 mL (AF350)

PSMA1 Conjugated Antibody

Sign In for Pricing
View Details