Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse SULT1A1 protein

This Mouse SULT1A1 protein spans the amino acid sequence from region 1-291aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aryl sulfotransferase Phenol sulfotransferase Phenol/aryl sulfotransferase

UniProt

P52840

Expression Region

1-291aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-291aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Extracellular Superoxide Dismutase ELISA Kit
MBS3809162-01 48 Well

Rat Extracellular Superoxide Dismutase ELISA Kit

Sign In for Pricing
View Details
Rat Extracellular Superoxide Dismutase ELISA Kit
MBS3809162-02 96 Well

Rat Extracellular Superoxide Dismutase ELISA Kit

Sign In for Pricing
View Details
Rat Extracellular Superoxide Dismutase ELISA Kit
MBS3809162-03 5x 96 Well

Rat Extracellular Superoxide Dismutase ELISA Kit

Sign In for Pricing
View Details
Rat Extracellular Superoxide Dismutase ELISA Kit
MBS3809162-04 10x 96 Well

Rat Extracellular Superoxide Dismutase ELISA Kit

Sign In for Pricing
View Details
Cell Cycle Assay Kit
CAK2006-01 50 Assays

Cell Cycle Assay Kit

Sign In for Pricing
View Details
Cell Cycle Assay Kit
CAK2006-02 100 Assays

Cell Cycle Assay Kit

Sign In for Pricing
View Details