Mouse CD133 protein
This Mouse CD133 protein spans the amino acid sequence from region 509-794aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Antigen AC133 homolog Prominin-like protein 1 CD_antigen, CD133
UniProt
O54990
Expression Region
509-794aa
Tag
N-terminal 6XHis-SUMO-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation; Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
48.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6XHis-SUMO-taggedExpression Region: 509-794aaSequence Info: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQLPEGKPKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
G1010 96 Tests
Probable ATP-dependent RNA helicase DDX6 (DDX6) Mouse ELISA Kit
Sign In for Pricing
View Details 
A13434-1-FITC 100 µg/Vial
Anti-PUS7 Antibody Picoband®, FITC Conjugate
Sign In for Pricing
View Details 364963 200 µL
S100B (S100 Calclium Binding Protein B, S100-B, NEF, S100Beta, S-100 protein subunit beta)
Sign In for Pricing
View Details