Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CD133 protein

This Mouse CD133 protein spans the amino acid sequence from region 509-794aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigen AC133 homolog Prominin-like protein 1 CD_antigen, CD133

UniProt

O54990

Expression Region

509-794aa

Tag

N-terminal 6XHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6XHis-SUMO-taggedExpression Region: 509-794aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQLPEGKPKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human soluble CD21 (sCD21) ELISA Kit
YP-W17880-01 48 Tests

Human soluble CD21 (sCD21) ELISA Kit

Sign In for Pricing
View Details
Human soluble CD21 (sCD21) ELISA Kit
YP-W17880-02 96 Tests

Human soluble CD21 (sCD21) ELISA Kit

Sign In for Pricing
View Details
NDUFS1 Recombinant Protein (Human)
RP020992 100 µg

NDUFS1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Lentiviral mouse Atf2 shRNA (UAS) - Lentiviral mouse Atf2 shRNA (UAS) (25)
GTR15203813 1 Vial

Lentiviral mouse Atf2 shRNA (UAS) - Lentiviral mouse Atf2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Hamster D-Aspartate Oxidase ELISA Kit
MBS086330-01 48 Well

Hamster D-Aspartate Oxidase ELISA Kit

Sign In for Pricing
View Details
Hamster D-Aspartate Oxidase ELISA Kit
MBS086330-02 96 Well

Hamster D-Aspartate Oxidase ELISA Kit

Sign In for Pricing
View Details