Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPB protein

This Human SFTPB protein spans the amino acid sequence from region 201-279aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

18KDA pulmonary-surfactant protein 6KDA protein Pulmonary surfactant-associated proteolipid SPL (Phe)

UniProt

P07988

Expression Region

201-279aa

Tag

Tag-Free

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 201-279aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDH 4.5 Indicator
FB45463-01 100 g

BDH 4.5 Indicator

Sign In for Pricing
View Details
BDH 4.5 Indicator
FB45463-02 250 g

BDH 4.5 Indicator

Sign In for Pricing
View Details
BDH 4.5 Indicator
FB45463-03 500 g

BDH 4.5 Indicator

Sign In for Pricing
View Details
BDH 4.5 Indicator
FB45463-04 1000 g

BDH 4.5 Indicator

Sign In for Pricing
View Details
BDH 4.5 Indicator
FB45463-05 2000 g

BDH 4.5 Indicator

Sign In for Pricing
View Details
Canine Angiopoietin-related protein 6 (ANGPTL6) ELISA Kit
MBS7204604-01 48 Well

Canine Angiopoietin-related protein 6 (ANGPTL6) ELISA Kit

Sign In for Pricing
View Details