Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SELM protein

This Human SELM protein spans the amino acid sequence from region 24-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SELENOM, SELM, Selenoprotein M, SelM

UniProt

Q8WWX9

Expression Region

24-145aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 24-145aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPARGC1B Antibody
DF12703-01 100 µL

PPARGC1B Antibody

Sign In for Pricing
View Details
PPARGC1B Antibody
DF12703-02 200 µL

PPARGC1B Antibody

Sign In for Pricing
View Details
OAAF00989-100UG - CD44 Antibody
OAAF00989-100UG 100 µg

OAAF00989-100UG - CD44 Antibody

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) rilpl2 Polyclonal Antibody
MBS7141593 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) rilpl2 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse RAPGEF3 shRNA Plasmid
abx981299-01 150 µg

Mouse RAPGEF3 shRNA Plasmid

Sign In for Pricing
View Details
Mouse RAPGEF3 shRNA Plasmid
abx981299-02 300 µg

Mouse RAPGEF3 shRNA Plasmid

Sign In for Pricing
View Details