Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial NFUA protein

This Bacterial NFUA protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NfuA, VV1_0864, Fe/S biogenesis protein NfuA

UniProt

Q8DDU2

Expression Region

1-194aa

Tag

Tag-Free

Source

E.coli

Origin

Vibrio vulnificus (strain CMCP6)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-194aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pEGFP-SNX26 Plasmid
PVTB00337-2c 2 µg

pEGFP-SNX26 Plasmid

Sign In for Pricing
View Details
ALS2 Knockout HAP1 Polyclonal Cells
ARG21793 1 Million

ALS2 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Human Gremlin 1 CLIA Kit
MBS8425517-01 1 Kit

Human Gremlin 1 CLIA Kit

Sign In for Pricing
View Details
Human Gremlin 1 CLIA Kit
MBS8425517-02 5x 1 Kit

Human Gremlin 1 CLIA Kit

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum ade Protein (aa 1-599) (strain 657 / Type Ba4)
VAng-Lsx7930-inquire Inquire

Recombinant Clostridium Botulinum ade Protein (aa 1-599) (strain 657 / Type Ba4)

Sign In for Pricing
View Details
Human DCAF15 Knockout HEK293T cell line
GTR15412920 1 Vial

Human DCAF15 Knockout HEK293T cell line

Sign In for Pricing
View Details