Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial NFUA protein

This Bacterial NFUA protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NfuA, VV1_0864, Fe/S biogenesis protein NfuA

UniProt

Q8DDU2

Expression Region

1-194aa

Tag

Tag-Free

Source

E.coli

Origin

Vibrio vulnificus (strain CMCP6)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-194aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CRMP2 (Thr509) Rabbit Polyclonal Antibody (BF488)
orb2518378 100 µL

Phospho-CRMP2 (Thr509) Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
VPS11 siRNA (Human)
CRJ0950-01 15 nmol

VPS11 siRNA (Human)

Sign In for Pricing
View Details
VPS11 siRNA (Human)
CRJ0950-02 30 nmol

VPS11 siRNA (Human)

Sign In for Pricing
View Details
CIITA (NM_000246) Human Over-expression Lysate
LY424845 100 µg

CIITA (NM_000246) Human Over-expression Lysate

Sign In for Pricing
View Details
CBI1 formic
T200596-01 10 mg

CBI1 formic

Sign In for Pricing
View Details
CBI1 formic
T200596-02 50 mg

CBI1 formic

Sign In for Pricing
View Details