Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial NFUA protein

This Bacterial NFUA protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NfuA, VV1_0864, Fe/S biogenesis protein NfuA

UniProt

Q8DDU2

Expression Region

1-194aa

Tag

Tag-Free

Source

E.coli

Origin

Vibrio vulnificus (strain CMCP6)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-194aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROSC (Proline Synthase Co-transcribed Bacterial Homolog Protein) (MaxLight 650)
MBS6224044-01 0.1 mL

PROSC (Proline Synthase Co-transcribed Bacterial Homolog Protein) (MaxLight 650)

Sign In for Pricing
View Details
PROSC (Proline Synthase Co-transcribed Bacterial Homolog Protein) (MaxLight 650)
MBS6224044-02 5x 0.1 mL

PROSC (Proline Synthase Co-transcribed Bacterial Homolog Protein) (MaxLight 650)

Sign In for Pricing
View Details
PUS7L Rabbit Polyclonal Antibody
orb1743820 100 µg

PUS7L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ikbkap (NM_026079) Mouse Tagged ORF Clone
MG211929 10 µg

Ikbkap (NM_026079) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Sucnr1 Rat shRNA Lentiviral Particle (Locus ID 408199)
TL700420V 500 µL Each

Sucnr1 Rat shRNA Lentiviral Particle (Locus ID 408199)

Sign In for Pricing
View Details
CD86 Protein Vector (Rat) (pPB-C-His)
PV258730 500 ng

CD86 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details