Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial CLFA protein

This Bacterial CLFA protein spans the amino acid sequence from region 228-558aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen receptor A Fibrinogen-binding protein A

UniProt

Q6GB45

Expression Region

228-558aa

Tag

Tag-Free

Source

E.coli

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 228-558aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Licochalcone D
TBZ1559 unit

Licochalcone D

Sign In for Pricing
View Details
TOPORS (Topoisomerase I Binding, Arginine/Serine-Rich, LUN, P53BP3, RP31, TP53BPL) (FITC)
MBS6175487-01 0.1 mL

TOPORS (Topoisomerase I Binding, Arginine/Serine-Rich, LUN, P53BP3, RP31, TP53BPL) (FITC)

Sign In for Pricing
View Details
TOPORS (Topoisomerase I Binding, Arginine/Serine-Rich, LUN, P53BP3, RP31, TP53BPL) (FITC)
MBS6175487-02 5x 0.1 mL

TOPORS (Topoisomerase I Binding, Arginine/Serine-Rich, LUN, P53BP3, RP31, TP53BPL) (FITC)

Sign In for Pricing
View Details
Recombinant Mouse FXYD6 Protein, His (Fc)-Avi-tagged
FXYD6-3404M 50 µg

Recombinant Mouse FXYD6 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Alanine Aminotransferase (ALT)
MBS2120582-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Alanine Aminotransferase (ALT)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Alanine Aminotransferase (ALT)
MBS2120582-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Alanine Aminotransferase (ALT)

Sign In for Pricing
View Details