Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRMP1 protein

This Human CRMP1 protein spans the amino acid sequence from region 1-572aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collapsin response mediator protein 1

UniProt

Q14194

Expression Region

1-572aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-572aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL2RG Conjugated Antibody
MBS9443577-01 0.1 mL (Biotin)

IL2RG Conjugated Antibody

Sign In for Pricing
View Details
IL2RG Conjugated Antibody
MBS9443577-02 0.1 mL (AF350)

IL2RG Conjugated Antibody

Sign In for Pricing
View Details
IL2RG Conjugated Antibody
MBS9443577-03 0.1 mL (AF405)

IL2RG Conjugated Antibody

Sign In for Pricing
View Details
IL2RG Conjugated Antibody
MBS9443577-04 0.1 mL (AF488)

IL2RG Conjugated Antibody

Sign In for Pricing
View Details
IL2RG Conjugated Antibody
MBS9443577-05 0.1 mL (AF555)

IL2RG Conjugated Antibody

Sign In for Pricing
View Details
IL2RG Conjugated Antibody
MBS9443577-06 0.1 mL (AF594)

IL2RG Conjugated Antibody

Sign In for Pricing
View Details