Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast PNC1 protein

This Yeast PNC1 protein spans the amino acid sequence from region 1-216aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nicotinamide deamidase

UniProt

P53184

Expression Region

1-216aa

Tag

Tag-Free

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-216aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apoa5 (NM_080434) Mouse Untagged Clone
MC203813 10 µg

Apoa5 (NM_080434) Mouse Untagged Clone

Sign In for Pricing
View Details
Abeta40 polyclonal rabbit affinity purified
218 203 50 µg

Abeta40 polyclonal rabbit affinity purified

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0154 protein SPH_1998 (SPH_1998), partial
MBS1136131-01 0.5 mg (E-Coli)

Recombinant Streptococcus pneumoniae UPF0154 protein SPH_1998 (SPH_1998), partial

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0154 protein SPH_1998 (SPH_1998), partial
MBS1136131-02 0.05 mg (Baculovirus)

Recombinant Streptococcus pneumoniae UPF0154 protein SPH_1998 (SPH_1998), partial

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0154 protein SPH_1998 (SPH_1998), partial
MBS1136131-03 0.5 mg (Yeast)

Recombinant Streptococcus pneumoniae UPF0154 protein SPH_1998 (SPH_1998), partial

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0154 protein SPH_1998 (SPH_1998), partial
MBS1136131-04 0.05 mg (Mammalian-Cell)

Recombinant Streptococcus pneumoniae UPF0154 protein SPH_1998 (SPH_1998), partial

Sign In for Pricing
View Details