Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Fe/S biogenesis protein NfuA (nfuA)

Product Specifications

Abbreviation

Recombinant E.coli nfuA protein

Gene Name

NfuA

UniProt

B1X760

Expression Region

1-191aa

Organism

Escherichia coli (strain K12 / DH10B)

Target Sequence

MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDLTEHQRGEHSYY

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VNN1 (Vanin 1, HDLCQ8, MGC116930, MGC116931, MGC116932, MGC116933, Tiff66) (FITC)
MBS6177042-01 0.1 mL

VNN1 (Vanin 1, HDLCQ8, MGC116930, MGC116931, MGC116932, MGC116933, Tiff66) (FITC)

Sign In for Pricing
View Details
VNN1 (Vanin 1, HDLCQ8, MGC116930, MGC116931, MGC116932, MGC116933, Tiff66) (FITC)
MBS6177042-02 5x 0.1 mL

VNN1 (Vanin 1, HDLCQ8, MGC116930, MGC116931, MGC116932, MGC116933, Tiff66) (FITC)

Sign In for Pricing
View Details
Olr1366 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7341708 1.0 µg DNA

Olr1366 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Lentiviral human HNRNPUL2 shRNA (UAS) - Lentiviral human HNRNPUL2 shRNA (UAS, iRFP) (100)
GTR15308946 1 Vial

Lentiviral human HNRNPUL2 shRNA (UAS) - Lentiviral human HNRNPUL2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
PDE6H Antibody (Center) [APR14240G]
APR14240G-01 50 µL

PDE6H Antibody (Center) [APR14240G]

Sign In for Pricing
View Details
PDE6H Antibody (Center) [APR14240G]
APR14240G-02 100 µL

PDE6H Antibody (Center) [APR14240G]

Sign In for Pricing
View Details