Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human USP7 protein

This Human USP7 protein spans the amino acid sequence from region 214-521aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Deubiquitinating enzyme 7 Herpesvirus-associated ubiquitin-specific protease Ubiquitin thioesterase 7 Ubiquitin-specific-processing protease 7

UniProt

Q93009

Expression Region

214-521aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 214-521aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2IP1 Protein Vector (Human) (pPM-C-His)
PV081924 500 ng

GTF2IP1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Gm6792 AAV Vector (Mouse) (CMV)
22182104 1 µg

Gm6792 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
LPPR4 Polyclonal Antibody, APC-Cy7 Conjugated
bs-11875R-APC-Cy7 100 µL

LPPR4 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Integrin Beta 5 (ITGB5) Antibody
abx013115-01 10 µg

Integrin Beta 5 (ITGB5) Antibody

Sign In for Pricing
View Details
Integrin Beta 5 (ITGB5) Antibody
abx013115-02 100 µg

Integrin Beta 5 (ITGB5) Antibody

Sign In for Pricing
View Details
Integrin Beta 5 (ITGB5) Antibody
abx013115-03 200 µg

Integrin Beta 5 (ITGB5) Antibody

Sign In for Pricing
View Details