Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FXN protein

This Human FXN protein spans the amino acid sequence from region 1-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Frataxin mitochondrial

UniProt

Q16595

Expression Region

1-210aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-210aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf162 3'UTR Lenti-reporter-Luc Vector
13836081 1.0 µg

C14orf162 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Goose Apolipoprotein O ELISA Kit
MBS067748 Inquire

Goose Apolipoprotein O ELISA Kit

Sign In for Pricing
View Details
SH2B2 Adenovirus (Mouse)
43648054 1.0 mL

SH2B2 Adenovirus (Mouse)

Sign In for Pricing
View Details
PE/Fire™ 744 anti-human CD279 (PD-1)
GT10705 100 Tests

PE/Fire™ 744 anti-human CD279 (PD-1)

Sign In for Pricing
View Details
ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (HRP) discontinued
A3575-98B-HRP 200 µL

ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Human F231L Protein
E30P11316 20 µg

Recombinant Human F231L Protein

Sign In for Pricing
View Details