Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FXN protein

This Human FXN protein spans the amino acid sequence from region 1-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Frataxin mitochondrial

UniProt

Q16595

Expression Region

1-210aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-210aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm31y 3'UTR Lenti-reporter-Luc Vector
38627084 1.0 µg

Rbm31y 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
C9orf7 CRISPR Knock Out 293T Cell Line (Human)
14818141 1x 10^6 Cells / 1.0 mL

C9orf7 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
RBM42 Knockout Cell Lysate
ABC-KC1686 100 µg

RBM42 Knockout Cell Lysate

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker)
MBS4380940-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

GATA-3 (Breast and Urothelial Marker)

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker)
MBS4380940-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

GATA-3 (Breast and Urothelial Marker)

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker)
MBS4380940-03 0.1 mg (Without BSA & Azide at 1mg/mL)

GATA-3 (Breast and Urothelial Marker)

Sign In for Pricing
View Details