Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CES1C protein

This Mouse CES1C protein spans the amino acid sequence from region 19-550aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Liver carboxylesterase N Lung surfactant convertase PES-N

UniProt

P23953

Expression Region

19-550aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 19-550aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC Class 1, HLA E (HRP)
M3886-06-HRP 100 µL

MHC Class 1, HLA E (HRP)

Sign In for Pricing
View Details
Lentiviral human CT55 sgRNA gene knockout kit - Lentiviral human CT55 sgRNA gene knockout kit (plasmid)
GTR15354268 1 Vial

Lentiviral human CT55 sgRNA gene knockout kit - Lentiviral human CT55 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
UNC5B Protein, Human, Recombinant (ECD, His Tag)
E45H50163M2-50 50 µg

UNC5B Protein, Human, Recombinant (ECD, His Tag)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Mucin 1 (MUC1)
MBS2042097-01 0.1 mL

APC-Linked Polyclonal Antibody to Mucin 1 (MUC1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Mucin 1 (MUC1)
MBS2042097-02 0.2 mL

APC-Linked Polyclonal Antibody to Mucin 1 (MUC1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Mucin 1 (MUC1)
MBS2042097-03 0.5 mL

APC-Linked Polyclonal Antibody to Mucin 1 (MUC1)

Sign In for Pricing
View Details