Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CTLA4 protein

This Mouse CTLA4 protein spans the amino acid sequence from region 36-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytotoxic T-lymphocyte-associated antigen 4

UniProt

P09793

Expression Region

36-161aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 36-161aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK 3 (phospho Ser189) Polyclonal Antibody
MBS8520512-01 0.1 mg

ERK 3 (phospho Ser189) Polyclonal Antibody

Sign In for Pricing
View Details
ERK 3 (phospho Ser189) Polyclonal Antibody
MBS8520512-02 0.1 mL (AF635)

ERK 3 (phospho Ser189) Polyclonal Antibody

Sign In for Pricing
View Details
ERK 3 (phospho Ser189) Polyclonal Antibody
MBS8520512-03 0.1 mL (AF610)

ERK 3 (phospho Ser189) Polyclonal Antibody

Sign In for Pricing
View Details
ERK 3 (phospho Ser189) Polyclonal Antibody
MBS8520512-04 0.1 mL (AF405S)

ERK 3 (phospho Ser189) Polyclonal Antibody

Sign In for Pricing
View Details
ERK 3 (phospho Ser189) Polyclonal Antibody
MBS8520512-05 0.1 mL (AF405L)

ERK 3 (phospho Ser189) Polyclonal Antibody

Sign In for Pricing
View Details
ERK 3 (phospho Ser189) Polyclonal Antibody
MBS8520512-06 0.1 mL (AF546)

ERK 3 (phospho Ser189) Polyclonal Antibody

Sign In for Pricing
View Details