Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial RELG protein

This Bacterial RELG protein spans the amino acid sequence from region 1-87aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative endoribonuclease RelG

UniProt

O33348

Expression Region

1-87aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-87aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PLK1 Antibody
RC-6007-01 50 μL

Recombinant PLK1 Antibody

Sign In for Pricing
View Details
Recombinant PLK1 Antibody
RC-6007-02 100 µL

Recombinant PLK1 Antibody

Sign In for Pricing
View Details
Recombinant PLK1 Antibody
RC-6007-03 1 mL

Recombinant PLK1 Antibody

Sign In for Pricing
View Details
ACADSB (NM_001609) Human Over-expression Lysate
LS000036 100 µg

ACADSB (NM_001609) Human Over-expression Lysate

Sign In for Pricing
View Details
Portable Ultrasonic Processor BLIH-401
BLIH-401 1 Unit

Portable Ultrasonic Processor BLIH-401

Sign In for Pricing
View Details
Human TG-ab (Thyroglobulin Ab) ELISA Kit
MBS8820066-01 48 Well

Human TG-ab (Thyroglobulin Ab) ELISA Kit

Sign In for Pricing
View Details