Bacterial RELG protein
This Bacterial RELG protein spans the amino acid sequence from region 1-87aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Putative endoribonuclease RelG
UniProt
O33348
Expression Region
1-87aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
26.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-87aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
056812-01 10 µg
Macrophage Derived Chemokine (MDC), Recombinant, Canine, His-Tag, GST-Tag
Sign In for Pricing
View Details 056812-02 50 µg
Macrophage Derived Chemokine (MDC), Recombinant, Canine, His-Tag, GST-Tag
Sign In for Pricing
View Details 056812-03 100 µg
Macrophage Derived Chemokine (MDC), Recombinant, Canine, His-Tag, GST-Tag
Sign In for Pricing
View Details 056812-04 200 µg
Macrophage Derived Chemokine (MDC), Recombinant, Canine, His-Tag, GST-Tag
Sign In for Pricing
View Details ![[One Step] CBX3 Antibody Kit](https://cdn.genprice.uk/genprice/uk/genprice4.webp)