Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse MGLL protein

This Mouse MGLL protein spans the amino acid sequence from region 1-303aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Monoacylglycerol lipase

UniProt

O35678

Expression Region

1-303aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-303aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SRD5A2 knockdown cell line
ABC-KD14657 1 Vial

Human SRD5A2 knockdown cell line

Sign In for Pricing
View Details
CSNK1G1 Antibody Blocking peptide
orb1446590 500 µg

CSNK1G1 Antibody Blocking peptide

Sign In for Pricing
View Details
hsa-miR-1224-5p miRNA Inhibitor
MIH01086 2x 5.0 nmol

hsa-miR-1224-5p miRNA Inhibitor

Sign In for Pricing
View Details
DNA Ligase 4 Antibody
E38PA7172 100 µL

DNA Ligase 4 Antibody

Sign In for Pricing
View Details
Recombinant Human C10orf82 Protein
E30P68414A 50 µg

Recombinant Human C10orf82 Protein

Sign In for Pricing
View Details
MPZL3 (NM_198275) Human Tagged Lenti ORF Clone
RC224069L4 10 µg

MPZL3 (NM_198275) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details