What is the catalog number for Bacterial FBPB protein?

The catalog number for Bacterial FBPB protein is orb418943.

What sizes are available for Bacterial FBPB protein?

Bacterial FBPB protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacterial FBPB protein come in?

Bacterial FBPB protein is available in 3 different pack sizes.

Is Bacterial FBPB protein in stock?

Bacterial FBPB protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacterial FBPB protein

This Bacterial FBPB protein spans the amino acid sequence from region 41-325aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

30KDA extracellular protein Acyl-CoA, diacylglycerol acyltransferase Antigen 85 complex B

UniProt

P21160

Expression Region

41-325aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium kansasii

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 41-325aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSRPGLPVEYLQVPSAAMGRSIKVQFQSGGDNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSVIMPVGGQSSFYSDWYSPACGKAGCTTYKWETFLTSELPQWLSANRSVKPTGSAAVGISMAGSSALILSVYHPQQFIYAGSLSALMDPSQGMGPSLIGLAMGDAGGYKASDMWGPSSDPAWQRNDPSLHIPELVANNTRLWIYCGNGTPSELGGANVPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNLDANGTHSWEYWGAQLNAMKGDLQASLGAR