Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial FBPB protein

This Bacterial FBPB protein spans the amino acid sequence from region 41-325aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

30KDA extracellular protein Acyl-CoA, diacylglycerol acyltransferase Antigen 85 complex B

UniProt

P21160

Expression Region

41-325aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium kansasii

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 41-325aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSRPGLPVEYLQVPSAAMGRSIKVQFQSGGDNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSVIMPVGGQSSFYSDWYSPACGKAGCTTYKWETFLTSELPQWLSANRSVKPTGSAAVGISMAGSSALILSVYHPQQFIYAGSLSALMDPSQGMGPSLIGLAMGDAGGYKASDMWGPSSDPAWQRNDPSLHIPELVANNTRLWIYCGNGTPSELGGANVPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNLDANGTHSWEYWGAQLNAMKGDLQASLGAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cytokeratin 20/Krt20 Antibody Picoband®, APC Conjugate
A02828-2-APC 100 µg/Vial

Anti-Cytokeratin 20/Krt20 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
C1orf170 (PERM1) (NM_001291367) Human Tagged ORF Clone
RC239333 10 µg

C1orf170 (PERM1) (NM_001291367) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse RuvB-like 1 ELISA Kit
MBS2885568-01 48 Well

Mouse RuvB-like 1 ELISA Kit

Sign In for Pricing
View Details
Mouse RuvB-like 1 ELISA Kit
MBS2885568-02 96 Well

Mouse RuvB-like 1 ELISA Kit

Sign In for Pricing
View Details
Mouse RuvB-like 1 ELISA Kit
MBS2885568-03 5x 96 Well

Mouse RuvB-like 1 ELISA Kit

Sign In for Pricing
View Details
Mouse RuvB-like 1 ELISA Kit
MBS2885568-04 10x 96 Well

Mouse RuvB-like 1 ELISA Kit

Sign In for Pricing
View Details