Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial RECR protein

This Bacterial RECR protein spans the amino acid sequence from region 1-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RecR, MRA_3752, Recombination protein RecR

UniProt

A5U941

Expression Region

1-203aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-203aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z-g-carboxy-Glu(OtBu)2-OH
C-1510.1000 1.0g

Z-g-carboxy-Glu(OtBu)2-OH

Sign In for Pricing
View Details
7-Hydroxycoumarin-3-carboxylic N-succinimidylester
FH146986-01 50 mg

7-Hydroxycoumarin-3-carboxylic N-succinimidylester

Sign In for Pricing
View Details
7-Hydroxycoumarin-3-carboxylic N-succinimidylester
FH146986-02 100 mg

7-Hydroxycoumarin-3-carboxylic N-succinimidylester

Sign In for Pricing
View Details
7-Hydroxycoumarin-3-carboxylic N-succinimidylester
FH146986-03 250 mg

7-Hydroxycoumarin-3-carboxylic N-succinimidylester

Sign In for Pricing
View Details
7-Hydroxycoumarin-3-carboxylic N-succinimidylester
FH146986-04 500 mg

7-Hydroxycoumarin-3-carboxylic N-succinimidylester

Sign In for Pricing
View Details
7-Hydroxycoumarin-3-carboxylic N-succinimidylester
FH146986-05 1000 mg

7-Hydroxycoumarin-3-carboxylic N-succinimidylester

Sign In for Pricing
View Details