Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CLDN3 protein

This Human CLDN3 protein spans the amino acid sequence from region 30-80aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Clostridium perfringens enterotoxin receptor 2

UniProt

O15551

Expression Region

30-80aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 30-80aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF16 Protein Vector (Human) (pPM-C-His)
PV047376 500 ng

ZNF16 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
HIRA Antibody
orb2672836-01 50 µL

HIRA Antibody

Sign In for Pricing
View Details
HIRA Antibody
orb2672836-02 100 µL

HIRA Antibody

Sign In for Pricing
View Details
HIRA Antibody
orb2672836-03 200 µL

HIRA Antibody

Sign In for Pricing
View Details
WNT10B Protein (N-His, Mus musculus (Mouse) )
P509674 100 µg

WNT10B Protein (N-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details
Thyroxine (T4) (PE)
T5460-01B-PE 100 µL

Thyroxine (T4) (PE)

Sign In for Pricing
View Details