Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli FABB protein

Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-] synthase 1

Product Specifications

Product Name Alternative

3-oxoacyl-[acyl-carrier-protein] synthase I Beta-ketoacyl-ACP synthase I

UniProt

P0A953

Expression Region

1-406aa

Tag

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-406aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pExpress-1-Serpinb6b Plasmid
PVT40521 2 µg

pExpress-1-Serpinb6b Plasmid

Sign In for Pricing
View Details
RARB Polyclonal Antibody, PerCP Conjugated
bs-0516R-PerCP 100 µL

RARB Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Human WDR9 (BRWD1) activation kit by CRISPRa
GA110049 1 Kit

Human WDR9 (BRWD1) activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin 5-Bromopentylamide (N-Biotinyl-5-bromopentylamine)
B1750-59-01 50 mg

Biotin 5-Bromopentylamide (N-Biotinyl-5-bromopentylamine)

Sign In for Pricing
View Details
Biotin 5-Bromopentylamide (N-Biotinyl-5-bromopentylamine)
B1750-59-02 100 mg

Biotin 5-Bromopentylamide (N-Biotinyl-5-bromopentylamine)

Sign In for Pricing
View Details
Osteopontin (OPN) Antibody-BIOTIN
MBS857148-01 0.1 mg

Osteopontin (OPN) Antibody-BIOTIN

Sign In for Pricing
View Details