Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial CAF1 protein

This Bacterial CAF1 protein spans the amino acid sequence from region 22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen

UniProt

P26948

Expression Region

22-170aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Yersinia pestis

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 22-170aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Exportin-2 Recombinant Antibody, RBITC Conjugated
bsm-61865R-RBITC-TR 20 µL

Exportin-2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
PTP-H1 (H-6) FITC
sc-515181 FITC 200 µg/mL

PTP-H1 (H-6) FITC

Sign In for Pricing
View Details
HSC70 Interacting Protein (HIP, AAG2, FAM10A1, FAM10A4, FLJ27260, HOP, HSPABP, HSPABP1, MGC129952, P48, PRO0786, Progesterone Receptor-associated p48 Protein, Protein FAM10A1, Putative Tumor Suppressor ST13, Renal Carcinoma Antigen NY-REN-33, SNC6, ST13,
MBS6481185-01 0.2 mL

HSC70 Interacting Protein (HIP, AAG2, FAM10A1, FAM10A4, FLJ27260, HOP, HSPABP, HSPABP1, MGC129952, P48, PRO0786, Progesterone Receptor-associated p48 Protein, Protein FAM10A1, Putative Tumor Suppressor ST13, Renal Carcinoma Antigen NY-REN-33, SNC6, ST13,

Sign In for Pricing
View Details
HSC70 Interacting Protein (HIP, AAG2, FAM10A1, FAM10A4, FLJ27260, HOP, HSPABP, HSPABP1, MGC129952, P48, PRO0786, Progesterone Receptor-associated p48 Protein, Protein FAM10A1, Putative Tumor Suppressor ST13, Renal Carcinoma Antigen NY-REN-33, SNC6, ST13,
MBS6481185-02 5x 0.2 mL

HSC70 Interacting Protein (HIP, AAG2, FAM10A1, FAM10A4, FLJ27260, HOP, HSPABP, HSPABP1, MGC129952, P48, PRO0786, Progesterone Receptor-associated p48 Protein, Protein FAM10A1, Putative Tumor Suppressor ST13, Renal Carcinoma Antigen NY-REN-33, SNC6, ST13,

Sign In for Pricing
View Details
H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-OH
M-2230.0005 5.0mg

H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-OH

Sign In for Pricing
View Details
ANAPC13 Protein Lysate (Mouse) with C-HA Tag
11876034 100 µg

ANAPC13 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details