Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial CAF1 protein

This Bacterial CAF1 protein spans the amino acid sequence from region 22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen

UniProt

P26948

Expression Region

22-170aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Yersinia pestis

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 22-170aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tram1 ORF Vector (Mouse) (pORF)
ORF060295 1.0 µg DNA

Tram1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
NDE1 CytoSection
TS400179P5 25 Slides

NDE1 CytoSection

Sign In for Pricing
View Details
mmu-miR-6922-5p Primers
MPM01657 150 µL / 10 µM

mmu-miR-6922-5p Primers

Sign In for Pricing
View Details
Snx25 (BC054725) Mouse Tagged Lenti ORF Clone
MR209392L4 10 µg

Snx25 (BC054725) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Nkx2-1 Mouse shRNA Plasmid (Locus ID 21869)
TR515509 1 Kit

Nkx2-1 Mouse shRNA Plasmid (Locus ID 21869)

Sign In for Pricing
View Details
HSH2D ORF Vector (Human) (pORF)
23977011 1.0 µg DNA

HSH2D ORF Vector (Human) (pORF)

Sign In for Pricing
View Details