Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial CAF1 protein

This Bacterial CAF1 protein spans the amino acid sequence from region 22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen

UniProt

P26948

Expression Region

22-170aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Yersinia pestis

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 22-170aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBA3D Human shRNA Lentiviral Particle (Locus ID 113457)
TL307444V 500 µL Each

TUBA3D Human shRNA Lentiviral Particle (Locus ID 113457)

Sign In for Pricing
View Details
Gm5908 Mouse siRNA Oligo Duplex (Locus ID 546052)
SR403027 1 Kit

Gm5908 Mouse siRNA Oligo Duplex (Locus ID 546052)

Sign In for Pricing
View Details
NBR1 Antibody
PHY3164A 150 μg

NBR1 Antibody

Sign In for Pricing
View Details
Flt-1 phospho-Tyr1213 Rabbit Polyclonal Antibody
E53P01886 100 µL

Flt-1 phospho-Tyr1213 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal HDDC3 Antibody
NBP1-82684 0.1 mL

Rabbit Polyclonal HDDC3 Antibody

Sign In for Pricing
View Details
SEC22B CRISPR Activation Plasmid (m2)
sc-422863-ACT-2 20 µg

SEC22B CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details