Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial CAF1 protein

This Bacterial CAF1 protein spans the amino acid sequence from region 22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen

UniProt

P26948

Expression Region

22-170aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Yersinia pestis

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 22-170aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E130309D14Rik sgRNA CRISPR Lentivector set (Mouse)
K4716201 3x 1.0 µg

E130309D14Rik sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Fut2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6860906 1.0 µg DNA

Fut2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
2xTaq PCR Mixture
E28IT0048 5x 1 mL

2xTaq PCR Mixture

Sign In for Pricing
View Details
Coiled-Coil Domain Containing 113 (CCDC113) Antibody
abx301711-01 20 µg

Coiled-Coil Domain Containing 113 (CCDC113) Antibody

Sign In for Pricing
View Details
Coiled-Coil Domain Containing 113 (CCDC113) Antibody
abx301711-02 50 µg

Coiled-Coil Domain Containing 113 (CCDC113) Antibody

Sign In for Pricing
View Details
Coiled-Coil Domain Containing 113 (CCDC113) Antibody
abx301711-03 100 µg

Coiled-Coil Domain Containing 113 (CCDC113) Antibody

Sign In for Pricing
View Details