Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial APR protein

This Bacterial APR protein spans the amino acid sequence from region 106-379aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SubC, apr, Subtilisin Carlsberg, EC 3.4.21.62

UniProt

P00780

Expression Region

106-379aa

Tag

N-terminal 10xHis-SUMO-tagged

Source

E.coli

Origin

Bacillus licheniformis

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-taggedExpression Region: 106-379aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphomevalonate kinase Recombinant Rabbit mAb
BS48885-01 50 µL

Phosphomevalonate kinase Recombinant Rabbit mAb

Sign In for Pricing
View Details
Phosphomevalonate kinase Recombinant Rabbit mAb
BS48885-02 100 µL

Phosphomevalonate kinase Recombinant Rabbit mAb

Sign In for Pricing
View Details
Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)
CSB-YP002399HU-01 20 µg

Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)

Sign In for Pricing
View Details
Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)
CSB-YP002399HU-02 100 µg

Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)

Sign In for Pricing
View Details
Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)
CSB-YP002399HU-03 1 mg

Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)

Sign In for Pricing
View Details
IDO1 (Indoleamine 2,3-dioxygenase 1, CD107B, IDO, INDO) (HRP)
MBS6180759-01 0.1 mL

IDO1 (Indoleamine 2,3-dioxygenase 1, CD107B, IDO, INDO) (HRP)

Sign In for Pricing
View Details