Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CTDP1 protein

This Mouse CTDP1 protein spans the amino acid sequence from region 178-341aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TFIIF-associating CTD phosphatase

UniProt

Q7TSG2

Expression Region

178-341aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 178-341aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1L2 (C-term) Rabbit Polyclonal Antibody
AP50141PU-N 400 µL

ALDH1L2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Olfr1318 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4278505 3x 1.0 µg

Olfr1318 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Asphd1 ORF Vector (Mouse) (pORF)
12563014 1.0 µg DNA

Asphd1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human UBIAD1 (UbiA Prenyltransferase Domain Containing Protein 1) ELISA Kit
MBS8806390-01 48 Well

Human UBIAD1 (UbiA Prenyltransferase Domain Containing Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human UBIAD1 (UbiA Prenyltransferase Domain Containing Protein 1) ELISA Kit
MBS8806390-02 96 Well

Human UBIAD1 (UbiA Prenyltransferase Domain Containing Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human UBIAD1 (UbiA Prenyltransferase Domain Containing Protein 1) ELISA Kit
MBS8806390-03 5x 96 Well

Human UBIAD1 (UbiA Prenyltransferase Domain Containing Protein 1) ELISA Kit

Sign In for Pricing
View Details