What is the catalog number for Mouse CTDP1 protein?

The catalog number for Mouse CTDP1 protein is orb418919.

What sizes are available for Mouse CTDP1 protein?

Mouse CTDP1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Mouse CTDP1 protein come in?

Mouse CTDP1 protein is available in 3 different pack sizes.

Is Mouse CTDP1 protein in stock?

Mouse CTDP1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Mouse CTDP1 protein

This Mouse CTDP1 protein spans the amino acid sequence from region 178-341aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TFIIF-associating CTD phosphatase

UniProt

Q7TSG2

Expression Region

178-341aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 178-341aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR