Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSAP protein

This Human PSAP protein spans the amino acid sequence from region 311-391aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proactivator polypeptide

UniProt

P07602

Expression Region

311-391aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 311-391aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis C Virus Antibody [1863]
orb1273146 0.1 mg

Hepatitis C Virus Antibody [1863]

Sign In for Pricing
View Details
Rat SP140 Nuclear Body ELISA Kit
SL1494Ra-01 96 Tests

Rat SP140 Nuclear Body ELISA Kit

Sign In for Pricing
View Details
Rat SP140 Nuclear Body ELISA Kit
SL1494Ra-02 48 Tests

Rat SP140 Nuclear Body ELISA Kit

Sign In for Pricing
View Details
Biotin-Linked Antibody to Ovalbumin (OVA)
MBS2008316-01 0.1 mL

Biotin-Linked Antibody to Ovalbumin (OVA)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Ovalbumin (OVA)
MBS2008316-02 0.2 mL

Biotin-Linked Antibody to Ovalbumin (OVA)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Ovalbumin (OVA)
MBS2008316-03 0.5 mL

Biotin-Linked Antibody to Ovalbumin (OVA)

Sign In for Pricing
View Details