Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial PRGJ protein

This Bacterial PRGJ protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PrgJ, STM2872Protein PrgJ

UniProt

P41785

Expression Region

1-101aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-101aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5-Dimethyl-4-iodobenzaldehyde
OR1098840 1 Each

3,5-Dimethyl-4-iodobenzaldehyde

Sign In for Pricing
View Details
Anti-p57 Kip2/CDKN1C Antibody Picoband® (Dylight488 Conjugate)
A01244-1-Dylight488 100 µg

Anti-p57 Kip2/CDKN1C Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
PMS2 Mouse Monoclonal Antibody
orb1816756-01 50 µL

PMS2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PMS2 Mouse Monoclonal Antibody
orb1816756-02 100 µL

PMS2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
GATA-3 Antibody
V4084-100UG 100 µg

GATA-3 Antibody

Sign In for Pricing
View Details
Human SOD 2 ELISA kit (10X96T)
LF-EK0106 10×96T

Human SOD 2 ELISA kit (10X96T)

Sign In for Pricing
View Details