Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial PRGJ protein

This Bacterial PRGJ protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PrgJ, STM2872Protein PrgJ

UniProt

P41785

Expression Region

1-101aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-101aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZC3HAV1 Recombinant Protein
PPT-16108 100 µg

Human ZC3HAV1 Recombinant Protein

Sign In for Pricing
View Details
Fetuin A Rabbit Monoclonal Antibody
AMRe85564-01 1 Each

Fetuin A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Fetuin A Rabbit Monoclonal Antibody
AMRe85564-02 50 µL

Fetuin A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Fetuin A Rabbit Monoclonal Antibody
AMRe85564-03 100 µL

Fetuin A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
1-Propyl-4-methylpyridinium bromide
IL-0223-HP-0025 25 g

1-Propyl-4-methylpyridinium bromide

Sign In for Pricing
View Details
Alphalipoic acid
MBS3608911-01 500 mg

Alphalipoic acid

Sign In for Pricing
View Details