Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat NOX4 protein

This Rat NOX4 protein spans the amino acid sequence from region 210-424aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kidney oxidase-1

UniProt

Q924V1

Expression Region

210-424aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 210-424aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Choline chloride - 99%
FC01179-01 0.5 Kg

Choline chloride - 99%

Sign In for Pricing
View Details
Choline chloride - 99%
FC01179-02 1 Kg

Choline chloride - 99%

Sign In for Pricing
View Details
Choline chloride - 99%
FC01179-03 2 Kg

Choline chloride - 99%

Sign In for Pricing
View Details
Choline chloride - 99%
FC01179-04 5 Kg

Choline chloride - 99%

Sign In for Pricing
View Details
Choline chloride - 99%
FC01179-05 10 Kg

Choline chloride - 99%

Sign In for Pricing
View Details
WNT7A Conjugated Antibody
orb1619733 100 µL

WNT7A Conjugated Antibody

Sign In for Pricing
View Details