Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HRP1 protein

This Bacterial HRP1 protein spans the amino acid sequence from region 1-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hrp1, Rv2626cHypoxic response protein 1, HRP1

UniProt

P9WJA3

Expression Region

1-143aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-143aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LPHN3 (Latrophilin 3) ELISA Kit
EK243515 96 Well

Human LPHN3 (Latrophilin 3) ELISA Kit

Sign In for Pricing
View Details
NDE1 Antibody Blocking Peptide
orb1500644 500 µg

NDE1 Antibody Blocking Peptide

Sign In for Pricing
View Details
2310050C09Rik Protein Vector (Mouse) (pPM-C-HA)
10408024 500 ng

2310050C09Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
DISC1 Recombinant Rabbit Monoclonal Antibody [JE35-55]
HA722727 100 µL

DISC1 Recombinant Rabbit Monoclonal Antibody [JE35-55]

Sign In for Pricing
View Details
Vti1a (NM_016862) Mouse Tagged ORF Clone Lentiviral Particle
MR202429L3V 200 µL

Vti1a (NM_016862) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Methyl 12-hydroxystearate
OR1040492-01 100 mg

Methyl 12-hydroxystearate

Sign In for Pricing
View Details