Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HRP1 protein

This Bacterial HRP1 protein spans the amino acid sequence from region 1-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hrp1, Rv2626cHypoxic response protein 1, HRP1

UniProt

P9WJA3

Expression Region

1-143aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-143aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine IL-3 Polyclonal Antibody
KP2125D-01 20 µg

Canine IL-3 Polyclonal Antibody

Sign In for Pricing
View Details
Canine IL-3 Polyclonal Antibody
KP2125D-02 100 µg

Canine IL-3 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Cricetulus griseus Histone H3-like centromeric protein A (CENPA)
MBS1415914-01 0.02 mg (E-Coli)

Recombinant Cricetulus griseus Histone H3-like centromeric protein A (CENPA)

Sign In for Pricing
View Details
Recombinant Cricetulus griseus Histone H3-like centromeric protein A (CENPA)
MBS1415914-02 0.1 mg (E-Coli)

Recombinant Cricetulus griseus Histone H3-like centromeric protein A (CENPA)

Sign In for Pricing
View Details
Recombinant Cricetulus griseus Histone H3-like centromeric protein A (CENPA)
MBS1415914-03 0.02 mg (Yeast)

Recombinant Cricetulus griseus Histone H3-like centromeric protein A (CENPA)

Sign In for Pricing
View Details
Recombinant Cricetulus griseus Histone H3-like centromeric protein A (CENPA)
MBS1415914-04 0.1 mg (Yeast)

Recombinant Cricetulus griseus Histone H3-like centromeric protein A (CENPA)

Sign In for Pricing
View Details