Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HRP1 protein

This Bacterial HRP1 protein spans the amino acid sequence from region 1-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hrp1, Rv2626cHypoxic response protein 1, HRP1

UniProt

P9WJA3

Expression Region

1-143aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-143aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amylin Polyclonal Conjugated Antibody
orb1618982 100 µL

Amylin Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal USP10 Antibody (9L6F3)
NBP3-16416-100ul 100 µL

Rabbit Monoclonal USP10 Antibody (9L6F3)

Sign In for Pricing
View Details
Zfp948 Protein Lysate (Mouse) with C-HA Tag
51197034 100 µg

Zfp948 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
PMVK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]
TA503448AM 100 µL

PMVK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]

Sign In for Pricing
View Details
Recombinant Xenopus laevis Acyl-CoA synthetase family member 3, mitochondrial (acsf3), partial
MBS1330392 Inquire

Recombinant Xenopus laevis Acyl-CoA synthetase family member 3, mitochondrial (acsf3), partial

Sign In for Pricing
View Details
7β,15α-Dihydroxy-3,11,23-trioxolanosta-8,17 (20) -dien-26-oic acid
M38502-01 100 mg

7β,15α-Dihydroxy-3,11,23-trioxolanosta-8,17 (20) -dien-26-oic acid

Sign In for Pricing
View Details